DPCstruct | MC32091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 154 ± 37 aa |
| Standard deviation of domain lengths | 37.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF19278- PF02538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847JDC1 | 67-314 | NWLQGGGINQDGEIHAVNSFEASSCGTGACAVKDGLNHAAAIWNPEGDMGDIEIWEMAEPLLYLGRNVKTNSGGYGKYRGGCGFETL… |
| A0A7T6Z798 | 243-400 | GGMGACPTKDGLSATGFPSGVRGTPVEIIESNSPLVIYQKELRPDSGGSGKYRGGLGQIIRFGVRTHKPWHFPTMFDCMHYPPRGLA… |
| A0A146IN89 | 196-356 | None |
| A0A0V0QH75 | 1-125 | None |
| A0A317VGJ3 | 99-204 | None |
| A0A2D5QGH8 | 179-394 | None |
| E7F6Z6 | 1138-1267 | None |
| A0A538A926 | 282-484 | None |
| A0A7C1BLX2 | 301-463 | None |
| A0A7W0JKY9 | 130-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.