DPCstruct | MC32090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4Z3C9 | 18-121 | VDPLTVRARAVVDATGHPCEIVKIIQEKTGPELNTPTGKILGEKSMWADRAESTVTDNVGEVFPGLYVAGMAANAVHGSPRMGPIFG… |
| A0A5C5FM35 | 2-87 | DPQTITAPIVLSFAGHDGPFGAFAVKRLVATGLVEKLGNMRTLDMRSAEDYIVNQTREVFPGLITGGMELSELDGASRMGATFGAM |
| A0A7J3LZM4 | 79-194 | None |
| A0A287X9Q9 | 41-162 | None |
| A0A4Y7JPI8 | 605-723 | None |
| K2SJC0 | 106-224 | None |
| L7J779 | 910-1028 | None |
| A0A5C3LGQ8 | 69-157 | None |
| A0A4Y9ZVN8 | 138-227 | None |
| A0A7J4LR75 | 10-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.