DPCstruct | MC32088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 43 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 57.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4YQC3 | 1-44 | MGYLICENCGGYYELQPGEYPEDFEKCQCGGKLQYKENLEFETA |
| A0A1V4TBR1 | 5-45 | GYLICEKCEGYYQLQEKEDPEDFESCECGGKLIFVENLIDY |
| A0A7J4TH01 | 284-323 | None |
| A0A1V4YNS3 | 137-181 | None |
| A0A2A2H4E5 | 24-72 | None |
| A0A1D2W714 | 2-43 | None |
| A0A3A5HCW6 | 40-77 | None |
| A0A3A5HKX0 | 107-150 | None |
| A0A7C6BUX4 | 19-56 | None |
| A0A2H4VTS0 | 45-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.