DPCstruct | MC32087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 14.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4YMB7 | 3-115 | KKLELKEIVLIGRSFEEYNSFFELAEIDNDNRILDVASGVSSFAAEANLKGCNVTAMDIIYGFSPYEIGKKCAQDLKIIIEKLDNAT… |
| A0A2V6HEK1 | 13-110 | GLRLDRVVLLGRTFEEYRRYFLLKPEELIARDVLDVAGGVSSFCAEANACGIRVISFDPIYSLSAEGIAARSEPDLEAVYRAIGNVP… |
| A0A5C7W3M8 | 109-226 | None |
| R8HRN4 | 9-126 | None |
| W6S7F4 | 1-92 | None |
| L0ED08 | 1-125 | None |
| A0A480BDV2 | 4-122 | None |
| A0A1M6BFM7 | 2-128 | None |
| Q1PXT9 | 2-99 | None |
| A0A1I3ZNL4 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.