DPCstruct | MC32083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N0H0F8 | 1-118 | MPTSPRPRHAPDVEELGWELNHATHWRDGLSQLAHTLAKAASRGTGVLESEIDLLHGQLADVGMQILDSYPDHVDPDRVGDWQLLAA… |
| A0A1X1Z0J7 | 106-221 | AEAGPNDPIPGTGERARFGQHVDELGPTLIDITATNDRLPRIAQTVARAVARRSGVDDNEIALFRQVVAETQVRVLSAYPEHAPRDV… |
| F5Z287 | 552-656 | None |
| A0A100X052 | 435-550 | None |
| A0A1W9ZZE7 | 177-280 | None |
| A0A557XH15 | 238-345 | None |
| A0A655ET70 | 1-106 | None |
| X8BKT6 | 190-281 | None |
| A0A822RVL8 | 317-419 | None |
| A0A7I7NQZ3 | 225-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.