DPCstruct | MC3208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6VHH0 | 15-120 | TASPREIEAQALLKAAKQLQDVVTNWDEKGAIGLQEALMFNRKLWSIFVSEAMRDDNPQSIEIRQNIANIGVFVLSQSSALQIKPEV… |
| A0A7Y6YSQ7 | 9-117 | GQTHGQNLTGRRLEGEAFMKAARLLSQAQGFMENKRLLGEALQYTQKLWTIVQADLKSENNKMDKNLKAQLLSLSLFVDEQCLLAIK… |
| A0A285R4Y5 | 2-106 | None |
| A0A7V7CWW7 | 12-131 | None |
| A0A2T0X2N6 | 12-116 | None |
| A0A0F3IJR5 | 2-93 | None |
| A0A1H2GYN3 | 2-94 | None |
| A0A7W6JCA3 | 2-100 | None |
| A0A2D6TVI4 | 18-142 | None |
| A0A7C8BE95 | 41-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.