DPCstruct | MC32072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 371 ± 32 aa |
| Standard deviation of domain lengths | 32.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 65.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060SIV2 | 1-446 | MPTPNNPAELQPTAAILERYYTALLGPFEEAYRRNMMEQSQRAALAAGRMPPGTSQGQMNPQARPGGMPGMPGQTQMPATMNMMPQA… |
| A0A0C3BIV7 | 554-915 | ATQVQSLCAIFSDLEMFLIRLMQNHASQARRQQQAAANPQAQPATTDGDTPMATGGTPAASAPTPTHSAAAGGSGGGGRPETPAPGS… |
| A0A2G8SE78 | 1-339 | None |
| A0A836DBM9 | 3-352 | None |
| A0A2H3ECA0 | 126-522 | None |
| A0A6G1SNM8 | 231-572 | None |
| A0A5M9JE04 | 1-386 | None |
| A0A5M9JB71 | 126-478 | None |
| A0A1Y2BH19 | 225-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.