DPCstruct | MC3207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9D0S9 | 1-99 | MRSPPPPQLGWASDHLKQAIWETKEAIAAGNHGQAASFVEHSVEAVHHAHAAQAQHPSDHLKKGIAHLKKGIKLAKRTSSTHRVEKA… |
| A0A849TW90 | 1-86 | ALAAANPHVSEAVEHARGAASHGKEGHADACVQHAEEALKHAMAAGAKNPHLDEGLKHLTEAVKHGKAGHAEACTEHASGGATHLA |
| A0A7C3Q3Z3 | 3-111 | None |
| Q3JAC3 | 21-111 | None |
| A0A1W1I8X4 | 42-145 | None |
| A0A1W6MUP3 | 14-109 | None |
| A0A1W9G7P9 | 11-110 | None |
| A0A3N9UV06 | 52-162 | None |
| A0A1Q7RS85 | 160-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.