DPCstruct | MC32064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 249 ± 47 aa |
| Standard deviation of domain lengths | 47.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 86.23 |
| Assigned Pfam label(s) | CL0707- CL0113- CL0123- CL0020- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1RDC6 | 14-262 | SGLLSVRADLFDDIISALTTATDCTSCHATVLPPLQTLSREGDDAFVQTMTAVCEALQLADDAVCAGEMQRSGPVLAHSLRGFTVNG… |
| A0A3B1IK04 | 2-218 | RLHLAEEKVCRDITELFRDDFIRALQESFLWPTEACALLLGPDCGHFDIYASWNITLPKVPKPPVVPPTPPKPGSPQSRVLFLTDIH… |
| A0A2A2KW71 | 91-323 | None |
| A0A7R9KHY8 | 95-371 | None |
| A0A0B7NJY8 | 17-299 | None |
| A0A7M7N2M6 | 62-322 | None |
| A0A482VNK5 | 134-419 | None |
| A0A7R8X4V0 | 60-379 | None |
| A0A0D8XYI9 | 2-212 | None |
| A0A1J9R5J9 | 83-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.