DPCstruct | MC3206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11390 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8E4T8 | 1-66 | MSPEKMVTMANQIATFFKSQPGTDQADRIAAHLSDFWDPRMRAQLQAYVSEGGKGLDALVLDAAQK |
| A0A4P5SQ70 | 1-74 | MSHNSVEKLVKMANQIGAFFGAQKASQSAAGMAEHLMKFWDPRMRALIIEHVAHGGTGLDPIALEAVKKLPPVK |
| A0A1H9JTF5 | 1-67 | None |
| A0A495VCS4 | 289-363 | None |
| A0A5C8PJ85 | 32-104 | None |
| A0A1M7RLP8 | 41-111 | None |
| A0A370HJN9 | 1-67 | None |
| A0A4R1VUN7 | 9-86 | None |
| A0A1P8UGZ4 | 1-67 | None |
| A0A344PLB2 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.