DPCstruct | MC32059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7HDB9 | 107-227 | PAGRPSFKSVVHDEAVLVASRRARDRLRAELKPRFIAGLSPGERLMVKAPFTTPAGGREWMWIRVARWQGPRIHGVLDNDPVHMRDL… |
| A0A210B383 | 2-102 | TDKFIEVMNKKDADTFAVKAPITDHGRTEHFWLTDVTYSNGMFIGVISNDPGIVTNVEYGQEWKIKKEDISDWMYTRGDKIYGGYTI… |
| A0A518AHY8 | 55-181 | None |
| A0A2G4GVV4 | 223-343 | None |
| A6VVG1 | 4-92 | None |
| A0A258L5H8 | 564-694 | None |
| A0A5J4Z4B9 | 18-131 | None |
| A0A6G7BUF7 | 3-91 | None |
| A0A0Q8WZY9 | 14-136 | None |
| V2UXZ4 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.