DPCstruct | MC32054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4EEX3 | 1-161 | MIWKWSLFLLSLDPLAEINKEVTDKLKTFLENFTGHWQDNTEFLNWISRIRSVVNKNGTDLAEKFAIRFGFESYNIERSILELQISD… |
| A0A6P8JHU5 | 8-154 | FVIVLQAGINECGLKSHAELIRLAIKADNKIKDLIHKVSGFVKGNSEFKENYENLRIPLMENYTSLPTKLAHIREFKAYNMERLHLE… |
| A0A0Q9XHS3 | 72-239 | None |
| B4GKU8 | 9-181 | None |
| A0A6P4IEM0 | 11-149 | None |
| A0A6P5U428 | 5-159 | None |
| A0A0Q9XED0 | 18-167 | None |
| A0A1W4W223 | 2-140 | None |
| A0A0P8XZC2 | 1-165 | None |
| A0A0Q5VXG9 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.