DPCstruct | MC32053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8CG53 | 1-71 | MDSQVQVDGRLLDIIDDNWRKEKLPEDDILVPLGELPDPESDNGNSSESVREQENKWTDLNLAWNTPHQPS |
| A0A6P8J8I9 | 1-68 | MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLALGSLAPD |
| A0A4U1F284 | 104-177 | None |
| A0A3P8X0D2 | 1-74 | None |
| A0A6I9WGB5 | 82-155 | None |
| A0A834FPJ6 | 191-264 | None |
| A0A6F8ZYT7 | 1-74 | None |
| A0A7E4SBK0 | 28-101 | None |
| A0A2K6FF38 | 1-65 | None |
| A0A6P8ICR1 | 12-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.