DPCstruct | MC32050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 216 ± 44 aa |
| Standard deviation of domain lengths | 44.29 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 57.85 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0363- PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PQ39 | 40-256 | KIHKAVDGSLKTERINGAIFFFNPRTGQLFLKIIPASVWAGHEPQRLSQLAKQKTAEEVAAWIRSLPAEEHPKQIIATRTGTLDALR… |
| A0A2J7REU4 | 3-211 | FDKTFEGSLTKKLISGAIFIFNPCTGQLFLKIIHTSVRAGQKRLKQLAKWKTTEEVAALIRSLPVEEQPKQIIVMRKGMLNPLEVQL… |
| A0A5E4G278 | 121-334 | None |
| A0A453Q1T0 | 2-126 | None |
| A0A3P7BAQ8 | 387-593 | None |
| A0A7S4PR46 | 690-935 | None |
| A0A7S0YUK7 | 669-882 | None |
| A0A2P6RSU2 | 25-222 | None |
| M4BI32 | 68-324 | None |
| A0A0K9RHG5 | 33-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.