DPCstruct | MC32045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844W9R6 | 2-147 | FYIGTNQPQVLTEIRRHILAEFQHLPVAGEYMHRDIYDIAEKYGKDTFLMIDKLGTDKMPFFFTMKGRTDAMLEKVSLFKPHFTDRF… |
| A0A2A8IBE8 | 2-136 | ELIRRKALSEFKNLPVAGEYMHREIYDIAKKYGKDSFIVINKLGTDRLPFLFGLKANAERILDQMKIFKPYLPDRILQKLSYLFPNH… |
| A0A7Z7KQA0 | 85-230 | None |
| A0A3S4GVR1 | 218-380 | None |
| A0A2I0GPY1 | 79-242 | None |
| A0A7V8FD07 | 651-811 | None |
| A0A6D0ENS3 | 27-145 | None |
| W1F6L0 | 1-147 | None |
| A0A0A2VUN8 | 206-351 | None |
| A0A813AQM3 | 335-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.