DPCstruct | MC32043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0QAQ7 | 10-140 | NWDPVDNTVLANEQVIDGKGWRSGAAVEKRDIPMYYFNITDYADELLDDLDQLEGHWPSEVLTMQRNWIGRSAGMEVHFPYELAGEE… |
| A0A844VY32 | 1-119 | VLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEGVEISFDVNHYADKLTVYTTRPD… |
| B9EZ91 | 534-706 | None |
| A0A2S3UQA8 | 157-277 | None |
| A0A0G1VWK9 | 189-313 | None |
| A0A6C8GRE5 | 4-100 | None |
| A0A453DR83 | 1-131 | None |
| A0A453DR90 | 6-110 | None |
| H0ECA0 | 43-180 | None |
| A0A843WQK8 | 431-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.