DPCstruct | MC32042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 18.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 66.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0ARX5 | 48-130 | LESLKTILGKMHQDAAPPASVEVFCYSQHLRGLIRTRVQQLVSECIELRLSTNRLEPGRFKALRIAGQTWGLFFERLNVSVQK |
| A0A844VWT8 | 1-136 | VRTLHFNGEQAMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQMISECIELRLSSTRQDTGRFKALRVSGQTWGLFFE… |
| A0A165UNW7 | 1-116 | None |
| A0A6L2ZQ34 | 611-745 | None |
| A0A090PMH9 | 180-317 | None |
| A0A6M1HV82 | 63-197 | None |
| A0A6I4KMG4 | 382-492 | None |
| A0A378NAF1 | 85-218 | None |
| A0A380QEA4 | 424-558 | None |
| A0A3B0LZX6 | 611-701 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.