DPCstruct | MC32041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 693 ± 67 aa |
| Standard deviation of domain lengths | 66.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0056- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1EJ17 | 1-740 | MPLHATLENNAATSQPLSAIFTVQTSPDTSLANYWGYMPETLTAKNGKVFSRPLLKAETGATASFNVNNEVWQKVTITQALNGTQGG… |
| A0A655E1Q9 | 1-643 | MPTVNDLQTLYTDYPNGALTTTLGLPVASGKYWVAGNSVPDATHSDSQFQYVRLSDNNTLTTKANTATAQLCLAKRRDLSIELTSSD… |
| A0A3S5D9Y5 | 27-756 | None |
| A0A1Y2S910 | 5-553 | None |
| A0A6C8H1D7 | 1-594 | None |
| A0A484X0F5 | 2-663 | None |
| Q8ZN55 | 1118-1864 | None |
| A0A447N6F0 | 290-1020 | None |
| A0A655E1M2 | 122-868 | None |
| A0A0K4MEI3 | 539-1276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.