DPCstruct | MC32040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 535 |
|---|---|
| Mean domain length (aa) | 291 ± 77 aa |
| Standard deviation of domain lengths | 77.48 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 79.51 |
| Assigned Pfam label(s) | CL0199- PF00122- CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655CAJ5 | 18-302 | KSLRLRYGNIDIAVNANGVSGDYFNVYGMSFREGNTFNAVQQQDRAQVVVLDANTRRQLFPNKANVVGEVVLAGNMPVIVIGVAEEK… |
| A0A6P1YC69 | 1-214 | MGLRRIISLALIIVISFSSYMYLKEKYNPTAVEIRFRGDLRNEEFRKIKKMLYLNVYSINYSMKYRQHKLIMTTGMDTQIIDIPIIY… |
| A0A7C1DY67 | 26-295 | None |
| A0A7D7L102 | 22-378 | None |
| H1YBQ4 | 152-370 | None |
| A0A2W6V755 | 16-298 | None |
| A0A2E0UNM4 | 20-354 | None |
| B1C3M6 | 7-335 | None |
| A0A523E9Y2 | 167-382 | None |
| A0A535A1R3 | 82-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.