DPCstruct | MC3204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538MQQ5 | 2-103 | FVYALHEPIDDFDALTPLPQWIAADPTWRTRWTLQAILALTDVAAQVRWNGDMRHQPSVGAALAPPTTFPYLVVKQDNNGTTFVVSA… |
| A0A2C7A6M8 | 3-121 | RQLYAYHISPMDFGWSLMSTTQQFMRTLLDYASPEISPKRVASNLADFGRFCEEALEAGDKVGWEGDFRGSETPRVMVLPGEVHPYL… |
| A0A242LBZ1 | 1-113 | None |
| A0A833P9V2 | 1-117 | None |
| A0A5E4TFZ8 | 1-104 | None |
| A0A0A8K599 | 2-109 | None |
| A0A4Q3WIT2 | 9-117 | None |
| A0A5Y3WB85 | 7-136 | None |
| A0A4R7KN86 | 2-116 | None |
| A0A238HI84 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.