DPCstruct | MC32036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4SR44 | 7-77 | GEGGEIFVLNMGEPVKILDLARNMIVLNGLVPDKDIEIKFTGLKPGEKMYEELFRDGDIRKDTGHSYIFAA |
| A0A7V0ITB4 | 67-143 | GEVFVLDMGEPVRIGDLAHRMIRLSGMVPGRDIEVEVIGSRPGEKMQEVLSYEPLQFTDNPKVSVTHPGYPGPVTVM |
| A0A0Q1BS48 | 392-463 | None |
| R5L3J2 | 17-91 | None |
| A0A7X7AD62 | 3-77 | None |
| A0A829R4C9 | 16-92 | None |
| A0A1F8V087 | 1-84 | None |
| A0A2X0W7A3 | 92-164 | None |
| A0A7C6A2J9 | 1-68 | None |
| A0A661THI7 | 364-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.