DPCstruct | MC32033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 252 ± 43 aa |
| Standard deviation of domain lengths | 43.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0WTV5 | 2-157 | QKYRAEDMVQTLAQQRGHDATRINVKPSFANRHVWKTLYEYDGRYYVDAVKLLWHAKPITGMSVQKLKLKRDLPWLDLTSQQAKDIE… |
| A0A3D2R0M4 | 13-259 | SKIATSFKAVWMYATLGYATHGLLDACTSYGTLLFWPFSYERIAWNNVSIIDPLFTLPILILILLSGYLKKIVLARLALIWGLFYLG… |
| A0A7G6DZ20 | 50-349 | None |
| A0A7V2UXK2 | 142-387 | None |
| A0A812IR61 | 322-582 | None |
| A0A7W0WL50 | 30-279 | None |
| A0A2H3NQ77 | 182-445 | None |
| A0A2V4UJA5 | 50-356 | None |
| L0EC39 | 52-273 | None |
| A0A7J4LKC7 | 161-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.