DPCstruct | MC32032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520L8B0 | 4-128 | YQPKIITAHTQAEFYSVNYKAKFLVQVLSQKVDYHFLMEVLDIKDNSHVLTISSEKFNPSSVYDEFGLNDFIDEEDKEVETHFLCLF… |
| A0A842VCR4 | 347-464 | LSTFKYGPRIKSAKLKRAYQIGSYFAYLFEEIESTTSMKYLFIMAIVKSGEKEPCFLISSEANAFKIGGSHYLCYFDGERHGNLGGS… |
| A0A7C5G3U2 | 2-115 | None |
| A0A521G1B3 | 7-138 | None |
| A0A2N1S7Q3 | 10-157 | None |
| A0A2D7WWH0 | 147-271 | None |
| A0A849G5P2 | 162-293 | None |
| A0A2D4SSS3 | 111-224 | None |
| A0A2D4SS42 | 133-232 | None |
| A0A366A8D6 | 43-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.