DPCstruct | MC32024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I0EKC5 | 2-84 | HVVRVRDGVAGGWATAEFDPARNKLTIQTQGVQVFRIDKDRIGIDWSRPVVLRIDGYNSQLLPRDSATLTFTVTPTGDWTLND |
| A0A352L005 | 141-234 | KLRFSTRSLRYSRCDWLRIEEQLVSYQPSTAEGEIDELDTLRLTTRNVALLRLSREIAGTVVIDGSELELRGAAEGLLPDVWFRRES… |
| A0A2D6N6C4 | 44-147 | None |
| A0A661WW83 | 592-690 | None |
| A0A2D5EPI5 | 353-452 | None |
| A0A7X7FCE7 | 8-92 | None |
| R7ZMX8 | 270-354 | None |
| A0A1W9P8D4 | 435-517 | None |
| A0A1F9X775 | 693-778 | None |
| A0A1V5Y189 | 232-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.