DPCstruct | MC32011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 231 ± 28 aa |
| Standard deviation of domain lengths | 28.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1UHR1 | 1-218 | MAAQPGWYPPGQTCYPPELPVYLRNVYELKTIVGMPSDDEVIGIHAVVQAARKASEIPGMHDPVLNMKLGDHLFSAQMAIYRSKYSL… |
| A0A0K6FTQ6 | 6-234 | MTDRPGWYPPTQICYPPELPTYLRNVYDLKPIVGVPIDADVIGIHAVVQAANRVSGAPGMHDPSLLMGLAGHLFSVQMAKYRSKFSL… |
| A0A0A1UHR8 | 2-245 | None |
| A0A5N5QAN3 | 13-231 | None |
| A0A5N5Q9Q3 | 1-288 | None |
| A0A0A1UHM9 | 1-238 | None |
| A0A0A1UHQ9 | 4-179 | None |
| A0A0K6FN97 | 1-260 | None |
| A0A074RV08 | 2-213 | None |
| A0A0K6FN24 | 1-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.