DPCstruct | MC3201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146INU7 | 1-81 | MGSPNLEVFKFGIYLFVPLFSLVYFGDPAWYHAHVVPYRDKLLPPLEKTVRDLPTEQSRVREELERIKQERMQRLREKNKD |
| A0A061HE61 | 1-89 | MAGPNLELFKFGMYLFFPLAVMVHYGDPEWYHRHVLPLRDQFWPAEESLYKPPRNATDVKASLEEFRQKRLAKREARLERERIEGLQ… |
| A0A0D0XE01 | 1-98 | None |
| A0A4S4LQV7 | 1-89 | None |
| A0A2I1EAY6 | 1-69 | None |
| M9MB57 | 35-120 | None |
| A0A427Y2A1 | 1-83 | None |
| A0A316ZAS2 | 1-88 | None |
| A0A4Q0A4W3 | 1-81 | None |
| A0A4P9XRC8 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.