DPCstruct | MC32007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 175 ± 33 aa |
| Standard deviation of domain lengths | 33.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 91.03 |
| Assigned Pfam label(s) | CL0023- PF00772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A502E3X7 | 1-143 | MDVLFLGALLWSTPADAADVLVLIRDVDMSTPSQEAVLAAIRRLVDAGTPPGPQLALDGLRRTGTLKHFAARDLADATTSGAQPMAL… |
| A0A2D5H404 | 12-167 | NDQSPESEQTVLGAALIEGPDKEIVAMLHYKDFYSEKHQYIWRSICYQYNNGNPTDVPSVIDVLKQYNLLEHSGGAYYLTELIDIPT… |
| A0A1H9WH12 | 2-171 | None |
| L0DHK3 | 20-198 | None |
| A0A7C7IRU1 | 2-214 | None |
| A0A2T2R1X5 | 1-169 | None |
| A0A3D5DL17 | 31-189 | None |
| A0A2M7II27 | 18-173 | None |
| A0A7V7WSC6 | 5-186 | None |
| A0A1R3L1X4 | 9-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.