DPCstruct | MC32005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 267 ± 60 aa |
| Standard deviation of domain lengths | 59.98 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0RRW8 | 65-342 | HALVSRNGRLYVQSLQIGRSSYEMLPSIKNGPGTAVTDYRVNAFQQLIEDSLLKPGGPTIPKGTAEKHLIETTEYWPLNNGSSVLFA… |
| A0A6P9B1C5 | 1-206 | MLSSHGGEIFLHVLSTSRSILEDPPSISEGCGGRVTDYRITDFGEFMRENRLAPFLEPRYKNDESLEVPLERAKDQLEKHTRYWPMI… |
| A0A212CCS4 | 272-511 | None |
| A0A0K0DJ77 | 1-257 | None |
| A0A0X3P352 | 2-175 | None |
| A0A061RKW6 | 119-342 | None |
| A0A2S2NR79 | 197-441 | None |
| A0A484BBA6 | 286-555 | None |
| S9WYZ6 | 143-340 | None |
| A0A7I8XKE5 | 685-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.