DPCstruct | MC32004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 251 ± 45 aa |
| Standard deviation of domain lengths | 44.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7YNZ8 | 1-269 | MVAQLACADCSRLFPTKIGLSQHRRHAHPTQHNADKLSRVKHSGARWSQQESQSLLRLANNLYPSCETQTALFARLEQYFPGRSAIS… |
| A0A0V0REC0 | 2-264 | ELHFKCVHNIRDFVFRCSKCEKSCPSINSVASHYPRCKGSVKAAVLFSSLANTRTTCGSSCGTFSGLQLHRKRAHPDVFAASCSKKT… |
| A0A4Y2UIQ0 | 1-280 | None |
| A0A1B0C6M5 | 7-184 | None |
| A0A6A4JTD7 | 36-308 | None |
| A0A4Y2T6V4 | 1-282 | None |
| A0A4Y2L918 | 93-374 | None |
| A0A6A4VLN7 | 2-243 | None |
| A0A4Y2LV97 | 14-281 | None |
| A0A444T124 | 7-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.