DPCstruct | MC32003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078HY96 | 696-766 | VIKEDKTAWRTDEEFAREMLAGLNPVVIQLLKEFPPKSKLERETYGDQNSTITKSHIEESLDGLTVEEALE |
| A0A0V0RAZ3 | 4-66 | DKFFWFRDEEFGRQTLAGLNPYSIKLVTEWPLKSELDPEIYGSPESAITTEMIEREIRGFVTI |
| A0A6J5X1F8 | 39-107 | None |
| A0A565BBN8 | 10-75 | None |
| A0A287FNC1 | 192-271 | None |
| A0A0A0KGV3 | 232-297 | None |
| A0A0A0LLS3 | 76-152 | None |
| A0A0A0L0K3 | 45-106 | None |
| A0A0A0L1W4 | 391-458 | None |
| A0A0A0LGD4 | 29-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.