DPCstruct | MC32000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7035 |
|---|---|
| Mean domain length (aa) | 158 ± 32 aa |
| Standard deviation of domain lengths | 31.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.93 |
| Pfam Score | 95.05 |
| Assigned Pfam label(s) | PF09621- CL0418- PF13862- CL0489- PF01016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3BCE2 | 1-88 | MIRKYNSNDLDSVLKIWLEASVKAHDFVSADFWESQVESMRNVYIPASEVFVYEIESKIVGFYALYENNLAAIFVFPAFQGQGIGKQL |
| A0A2I5K1P8 | 8-150 | VTAPDVFALLQEHLKSMTMHSPPESIHALNADRLRQPDVTFWSARENGILLGCGALKELNSRHGEIKSMKTSPHHVRKGVANRILRH… |
| A0A1Q6YRZ4 | 20-199 | None |
| A0A7V2V3G1 | 421-575 | None |
| A0A7V3AFF1 | 107-259 | None |
| A0A535W5L9 | 13-165 | None |
| A0A1Y4HAH5 | 5-87 | None |
| Q977W4 | 5-143 | None |
| A0A7V2UA15 | 282-516 | None |
| A0A3N0AWF4 | 18-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.