DPCstruct | MC3200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 214 ± 62 aa |
| Standard deviation of domain lengths | 61.55 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.02 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF08082- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8XJP4 | 117-303 | MPPEHIRKIIRDHGDMSSRKYRHDKRVYLGALKYMPHAVMKLLENMPMPWEQIRDVKVLYHITGAITFVNEIPWVIEPVYIAQWGTM… |
| A0A061H0G8 | 1-191 | MPPEVLRKVVKDHGDTSNCKYRQDKRVHLGTLKYVPHAMMKVLENIPMPWEQVREVPALYHITGAITFANEVPKVIKPVFHAQWATL… |
| A0A819ZRB8 | 2-172 | None |
| A0A3P7EFR5 | 1-185 | None |
| A0A7J7IGT9 | 1-310 | None |
| U6LXD5 | 1-204 | None |
| A0A1D6NUH7 | 37-304 | None |
| V9IH21 | 85-274 | None |
| B8C3V5 | 468-837 | None |
| A0A3Q2DZD3 | 10-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.