DPCstruct | MC320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J2HIS9 | 11-155 | PLVAVVAGGLTAALLDILYAFAAFSLRDVGPVRVLQSVASGLLGKASYQGGLATAALGGLLHAAIALVMAAVYVAASRSLPALNKRP… |
| A0A1I6KUY6 | 1-162 | MSTVLSMKAGPAPRSAAILLGTGLLVATVDAIFACTYWHMAAGLPAARIFQGIAAGLLGKAAFQGGAATVWLGAALHYGMAIVMVLA… |
| A0A7W5WHW8 | 24-170 | None |
| A0A3D8V9M2 | 2-132 | None |
| A0A4S3KEF0 | 8-149 | None |
| A0A418NKK0 | 2-143 | None |
| A0A7Y8SXQ1 | 1-173 | None |
| A0A1I5P6T7 | 25-157 | None |
| A0A838VFJ1 | 8-132 | None |
| E6PHB4 | 6-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.