DPCstruct | MC32
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 244 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124HPK6 | 250-506 | SEESGPRALPPAESEPAAEEAPDDLKALRLERAQSEALGWSRGQAELVAAAAAGQLYRDFGAVLRTVPVPGHPGRVASMHRLGPLVD… |
| A0A6G4WTA3 | 3-215 | DKQRAHALQWSAGQAELVAAADAGQLRYGQDGVLREHPQPGQAGRTVADGRLVPLLRAGFLTRDGERVAVTADGRAAVRLWRRWRPA… |
| A0A852VEJ5 | 7-244 | None |
| L7F447 | 37-269 | None |
| A0A3M8WDL7 | 141-347 | None |
| V9Z3U1 | 935-1197 | None |
| V9Z6H4 | 112-353 | None |
| A0A1V2MGQ7 | 37-281 | None |
| A0A101QXC1 | 100-346 | None |
| A0A7U3UT87 | 615-882 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.