DPCstruct | MC31999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I5JX69 | 10-99 | KTPKRIDVSSSNNLQIKLVLKQLDDLGYDVHLFDITLETDIPAVWVLAVNRKDGVNLKYYNAAGAHYNPEKAIFSGLVEVATSALIY… |
| D9VV01 | 104-197 | GQRLTEIDLDSVPGPAVRMMVDRAALQGYDVHAFDNRIDLAVPVVTGLAVRRDGGPGLYSFGAGAALDPASAVEAALSEVLTYIPHL… |
| A0A7V7WJG5 | 52-158 | None |
| A0A8A6PIL3 | 369-463 | None |
| A0A1B3PWR0 | 1-85 | None |
| A0A1I4GST3 | 10-111 | None |
| A0A6L6H7I5 | 149-249 | None |
| A0A3E2YNH5 | 658-753 | None |
| A0A7V2RTM1 | 2-115 | None |
| A0A0J5GWT2 | 290-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.