DPCstruct | MC31995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 255 |
|---|---|
| Mean domain length (aa) | 270 ± 50 aa |
| Standard deviation of domain lengths | 49.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 74.62 |
| Assigned Pfam label(s) | CL0126- CL0700- PF20509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2KKS9 | 12-288 | EVTDRIIAELEAGRVPWVQPWGKAKAGVGLPRNAATERSYSGINILILWGAVIEKGYAAQHWLTFRQALALGGHVRKGERGTTVVYA… |
| A0A374BH29 | 5-248 | DKYEVVKQAWFEINEHLRNNKQDYIEYLKFSAKMYKQPYSDAVLVYQQNRNATKIAEYKKWGRLGRYVRRGSHGVAVFGKNHTCRYL… |
| A0A3S4P3E2 | 808-1107 | None |
| A0A6S6Y8Q9 | 7-286 | None |
| A0A6S6XL05 | 12-314 | None |
| A0A1H0F0I6 | 2-236 | None |
| I0X6E9 | 12-277 | None |
| A0A7Y3LK33 | 6-192 | None |
| A0A2A4RRY9 | 12-293 | None |
| A0A2V4ESU3 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.