DPCstruct | MC31991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0469 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0ZH90 | 2-74 | KKSWLVLDNEYKPIKHITEFIKYLRNVDKSPCTIKGYAHSLKLYWEFLAAHEIDWTVINIGILAKFVGWLRTC |
| A0A269ZCV3 | 1-74 | MRVQEVFLENHSKRYMLIDDVGVPILPVLKYLKYLDTTGKSTNTQKTYCYALKQYFDYLNQKNINYSLVKLEHL |
| A0A2C6LIG0 | 1-83 | None |
| A0A844MXG5 | 1-77 | None |
| A0A2N3WFJ3 | 1-80 | None |
| A0A3D1SQS8 | 1-70 | None |
| A0A1E8B5V9 | 1-83 | None |
| A0A380XTN9 | 1-84 | None |
| I0WUI0 | 6-82 | None |
| X8AAC9 | 26-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.