DPCstruct | MC3199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842UME7 | 2-86 | RYFVLRSGTRDTNHVFTGSQPRRAALKAATRGFKNITLRERGTKKLHVYRGNRKRVRAPEGSPDWLPSRVWKPVVRKKGIKRLDR |
| A0A4U7EUM0 | 4-109 | EDGKRNFALREADGSEPSEFSGNMPRQAALKAARTLEPAPSEAEAERTTLRLREKGTQKVHEYEGWAWKDSAPEVDEADDDFWLNDL… |
| A0A800UG57 | 3-89 | None |
| A0A822J2L9 | 10-107 | None |
| A0A497IEV4 | 23-111 | None |
| A0A2H9TFK2 | 308-414 | None |
| H8I9M7 | 16-114 | None |
| A0A519BR44 | 1-84 | None |
| A0A257MSS2 | 2-93 | None |
| U1NGM9 | 30-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.