DPCstruct | MC3198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 327 ± 49 aa |
| Standard deviation of domain lengths | 49.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W3WXH0 | 633-912 | ITRCGQGERVRTFGRKWFQPVSGPKDLVVCAACYCDEVIHTGEEPKWTIVPGLTEARDTHIRCALGGQFNIKIAMARAQEKKDFSCF… |
| A0A6A6FFK2 | 27-364 | LPPCPRQDPVAGKDDWYTITGHTNIDFCPDCIDTLFERTIFRNLFRRSLPRSYSEKVRCAFGSPWIRLAWLLTLQQHRTDLTLLQDI… |
| A0A1Y2DQL8 | 409-784 | None |
| A0A166BLS1 | 38-470 | None |
| A0A0G2H4F5 | 8-254 | None |
| A0A4Q4W7S2 | 1-229 | None |
| A0A1B7XXY4 | 331-637 | None |
| W9VVR1 | 3-255 | None |
| A0A194XDX1 | 5-388 | None |
| A0A1L7XBF0 | 85-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.