DPCstruct | MC31974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X2KQR0 | 1-135 | MHKRKYTGLGLRWREEKWEDEDEENAQLLLEALRVLDRLKNIACPFLEGLYITRPRTMKQFLCTPSICRLLILEWLFARLYPSFGVS… |
| A0A1A8CGC7 | 7-116 | EEQVARQLYDALQAAACPLVQGLYLKEDDSMLELLCSPSELRTDILAWICSRIDPNVANSKAARSHDPHALTKEMAAFGHELMLIQA… |
| A0A6I8R0C5 | 3-97 | None |
| B4DXP4 | 1-115 | None |
| A0A667IF58 | 1-112 | None |
| A0A7N4P978 | 2-100 | None |
| A0A7J7R478 | 15-137 | None |
| Q4T950 | 4-100 | None |
| A0A1S3LGT3 | 77-205 | None |
| A0A6J0CIH3 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.