DPCstruct | MC31971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 455 ± 106 aa |
| Standard deviation of domain lengths | 105.80 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816NH46 | 44-500 | DKEIKGQSISIKGPKTDSPIIAIEGFCKSNNISKADLVIQEVKGTKCYFYEKEITTQEVKSILFKSLAQPIMDYVWSKSMYWSDYKI… |
| A0A090SSJ7 | 3-285 | EQEFTIDSAEQYPAILEERGKVMADYEARKAIILADSQKAAAAVGGVADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPSEALVYT… |
| A0A0F3GXU4 | 1-452 | None |
| A0A835RSR4 | 267-836 | None |
| A0A6A2YRW7 | 16-370 | None |
| A0A5S9MB94 | 6-395 | None |
| A0A7E4SGB0 | 252-605 | None |
| A0A830HSS1 | 439-1145 | None |
| A0A7V0V6W4 | 3-579 | None |
| A0A1W9W6U1 | 15-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.