DPCstruct | MC3197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 88.77 |
| Assigned Pfam label(s) | CL0229- PF12998- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4QDI9 | 49-114 | DAIDPDEPRYCLCDQISFGEMILCDNDLCPIEWFHFSCVSLSIKPKGKWFCPKCRGDRPNVMKPKG |
| A0A6A6FDM9 | 2-73 | NEQDNHAEEVEEASTREPKKKYCYCNGPDSGRMLACDGEQCKTEWFHFECLGLEKAPESKKWYCDDCLIVEE |
| A0A177WT71 | 200-279 | None |
| A0A146H713 | 261-352 | None |
| A0A4S8MXF8 | 284-356 | None |
| J9AE33 | 7-81 | None |
| A0A158RAT5 | 282-348 | None |
| M1VKV6 | 174-253 | None |
| A0A7M7HI18 | 83-157 | None |
| K3W5X1 | 202-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.