DPCstruct | MC31965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6MYJ8 | 1-96 | MSEQDKFVRQYVNALAGDYRAQQDVAFSFSLTDGYGGPVVTNPIQACAWAKVISASGSPYVTAADQSSMVIKCSDLRPMDLEAAAAR… |
| A7IP07 | 82-175 | MTAFRTTYVKAFRNDLAAQRVVAFTLWRGNDVVSSDWIPACTWYMTMIALGSPKLEELDYQNMRKACSLLRPDQVEVAKNRARALGH… |
| A0A7W9R8W7 | 100-201 | None |
| A0A3S0AW16 | 30-125 | None |
| A0A5Q0C1J4 | 4-103 | None |
| A0A285M8C2 | 59-161 | None |
| A0A5N7ZGM6 | 21-117 | None |
| A0A389MUN7 | 39-129 | None |
| A0A023D947 | 128-236 | None |
| A0A2J7VFG2 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.