DPCstruct | MC31963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 277 ± 18 aa |
| Standard deviation of domain lengths | 18.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 16.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9H051 | 56-339 | SVGNTVGEYLLSPEIIIDSISNNDNNEKLQEWVKGNIERLKGNEKSIRELTGLSKEEFKKYQILIENNIVNYINSKMEIPEYKQKSI… |
| A0A444IWP3 | 7-282 | SDQFRETLNKVIPEQLEKFGTRRLDEILRAEDRKGFYCFTEACLEKMAASPDNTKLLARRIQEGLTEAAVSGKAVEDFLPEELVQLI… |
| A0A7W0YLI8 | 138-406 | None |
| A0A7S1GVK1 | 125-401 | None |
| A0A356KXQ1 | 5-277 | None |
| A0A410PQH1 | 3-251 | None |
| A0A7Y2DRL7 | 80-338 | None |
| A0A1M5P638 | 29-307 | None |
| A0A7S3V5L0 | 69-335 | None |
| A0A7S2IMB3 | 94-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.