DPCstruct | MC31958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 114 ± 20 aa |
| Standard deviation of domain lengths | 19.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 93.10 |
| Assigned Pfam label(s) | CL0040- CL0494- CL0424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6YBA4 | 23-136 | LQYNRGFRVSKELQKAISWIICNSLSDPRLKVLITVLEVQISRDFKYSKIYISIFESCTTLSSKDILLILRKSSKYIRFLLSKKVRL… |
| G8N803 | 5-89 | AHLEERLKRALAEAIQGLEDPRLFLLTVEAVRLSPDGRVLTAYVEAFQEEAKALQALGHAKGRLLAALARRVRLRRLPELEFLPW |
| A0A1L7RPW9 | 5-121 | None |
| A0A7R9XRM7 | 23-148 | None |
| A0A7S2SUM5 | 61-194 | None |
| A0A3S0ZC18 | 62-200 | None |
| A0A818Z9K7 | 276-402 | None |
| A0A0R3UC96 | 4-89 | None |
| A0A7S2CBT6 | 9-131 | None |
| A0A554K0E4 | 5-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.