DPCstruct | MC31953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S6U5P1 | 74-145 | FDSWNEVKKEVNKREGGYTVKPKNIYWVNLGLNVGDEEFGKGKKFLRPVLAIKQVTKNLFIGMPLTTTIRED |
| A0A0G0L188 | 1-84 | MTQKNYKDWHVLKSEIENVGQEKKFREREIWWCSLGENIGFEQDGKNEKFERPVLILRKFNCGMFFGIPLTSQKRRIVFMRDLL |
| A0A349H693 | 49-122 | None |
| A0A288D9Z8 | 2-78 | None |
| A0A6I0EBM8 | 99-174 | None |
| A0A845DAA0 | 1-76 | None |
| A0A845DCX5 | 18-88 | None |
| A0A0L0LN28 | 1-72 | None |
| A0A2H0M3S9 | 197-268 | None |
| A0A1G2P7X6 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.