DPCstruct | MC31952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4Y621 | 1-128 | MLSDGTQNPAYRRAMRSADRFDQELLRLRKQSAKPEKLRAASGDRAVDRYIQGHVAQKSLQPDDKAELRNQARQMADKRLTDRKKAI… |
| A0A235CI08 | 93-214 | RDGTWNPEYRRARRNRENFELEAERLLNQSAQPALLKPHTGTLDIDRYIMTLIAQTTLQPADEDKIRNLARKIVNYRISDRKKQILM… |
| A0A1I3ZW83 | 280-420 | None |
| A0A381C4G8 | 195-323 | None |
| A0A243T3Z9 | 182-310 | None |
| A0A2E8G042 | 2-107 | None |
| A0A4Q7YUN7 | 242-368 | None |
| F8FYH5 | 109-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.