DPCstruct | MC3195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 177 ± 29 aa |
| Standard deviation of domain lengths | 28.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4MTV1 | 18-216 | MPTDWGWECCIHIVLRRLNGMKRWCNKKWETVDNPTTILLEIIFQVCVQGMVVDSNDPDADSKKRLQGTYAEFLGLPFDIRAHNGLT… |
| A0A6A6FA73 | 12-150 | SYESLYQEIFFQHCCSTTTKAKLRWLNEKHGDRLRLPLVLFMHSPLRLSVAHREHGFGMHTGWPSNTSPVDVRERIANDEENNMLIE… |
| A0A139HAW4 | 96-317 | None |
| A0A4U7AKG8 | 806-1003 | None |
| J3PAN2 | 143-279 | None |
| A0A194XV16 | 164-378 | None |
| W6Y889 | 289-516 | None |
| A0A4U0V9D1 | 228-392 | None |
| A0A1V8SN61 | 930-1099 | None |
| A0A842ZD31 | 180-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.