DPCstruct | MC31949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 117 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0IY62 | 1-109 | MQLSDFEYNLPPELIAQHPLAVRSASRLLCLNKSTGEIQHRLFSAVIELLTEKDLLVLNNTRVIPARLLGRKATGGQAEVLIERILD… |
| A0A7W0X5Q0 | 21-140 | DFDLPRELIAQAPAPERTKSRLLHVDGERLADFAFADLPGLVPAGDLIVCNDTRVINARVHAQKTTGGKVELLVERIVASDEAWVQL… |
| A0A378W310 | 1-95 | None |
| A0A0G0NFD9 | 324-435 | None |
| A0A5C8KMZ1 | 367-484 | None |
| A0A2W4PCE0 | 6-163 | None |
| A0A1M3SZH3 | 1-136 | None |
| A0A812NKX3 | 1-120 | None |
| A0A6A0ASZ2 | 242-393 | None |
| A0A6L8QBD0 | 29-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.