DPCstruct | MC31942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 227 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7L8G8 | 1-224 | MYQVVPGGAGGTITDVIPKQKHTKDSRSLVGAGVIGLFLVIAAVAAWCYYIASLRKAELLKTQLLDLNKDGYIIRNQGGSIVFRMDF… |
| A0A3Q3INZ6 | 9-227 | KRKPPDCRAGGTNTDVLPKQKHNRDTRPLVGAGVIGLVLVIAAVAAWCYYIASLRKAELFKTQLLDLNKDGYIIRNQGGSIVFRMDF… |
| A0A6P4XR02 | 64-286 | None |
| A0A2C9K952 | 1-223 | None |
| A0A151M1R1 | 15-231 | None |
| A0A6H5IV47 | 226-450 | None |
| A0A433SXX9 | 47-282 | None |
| A0A4X1UTA9 | 25-238 | None |
| A0A0K2TUR4 | 126-373 | None |
| A0A1B0CC67 | 585-820 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.